Pobieranie prezentacji. Proszę czekać

Pobieranie prezentacji. Proszę czekać

Transkrypcja genów jądrowych u roślin i jej regulacja.

Podobne prezentacje


Prezentacja na temat: "Transkrypcja genów jądrowych u roślin i jej regulacja."— Zapis prezentacji:

1 Transkrypcja genów jądrowych u roślin i jej regulacja

2 Maszyneria transkrypcyjna - prokarionty Mechanizmy regulacji ekspresji genów różnią się zasadniczo u eukariontów i prokariontów. U prokariontów stan podstawowy dla transkrypcji jest nierestrykcyjny (brak ograniczenia dostępności do DNA dla kompleksu RNA polimerazy). Negatywna regulacja jest rzadka i zależy od represorów specyficznych dla konkretnych sekwencji. U prokariontów sieć regulatorowa genów ma niską złożoność. Pojedynczy TF reguluje średnio 3 geny, a pojedynczy gen jest pod kontrolą średnio dwóch TF. Wiele promotorów regulowanych jest przez pojedynczy regulator. Regulatory te rzadko regulują transkrypcję innych TF. U prokariontów, wiążące się z DNA, specyficzne sekwencyjnie TF na ogół rozpoznają długie sekwencje (>12 par zasad).

3 Maszyneria transkrypcyjna - eukarionty U eukariontów stan podstawowy dla transkrypcji jest restrykcyjny, co wynika z upakowania DNA w chromatynę, która uniemożliwia rozpoznawania standardowych promotorów przez podstawową maszynerie transkrypcyjną. Wpływ struktury chromatynowej promotora na jego dostępność czyni niezbędnym udział w regulacji transkrypcji czynników modyfikujących chromatynę. Określa to w zasadniczy sposób model regulacji transkrypcji u eukariontów. W systemie regulacji uczestniczą nie tylko składniki podstawowej maszynerii transkrypcyjnej i wielka liczba TF wiążących się ze specyficznymi sekwencjami DNA, ale także bardzo liczne i rozmaite białka związane z chromatyną. U eukariontów regulatory transkrypcji działają według logiki kombinatorycznej, co skutecznie zwiększa liczbę i różnorodność aktywności regulatorowych i prowadzi do dużej złożoności sieci regulacyjnych. Sekwencje rozpoznawane przez eukariotyczne TF mają długość 5-10 par zasad.

4 Polimerazy RNA u eu- i prokariontów Pro: podjednostki 2Xalfa, β, β, ω (omega) (Holoenzym ca D) Eu: 12 podjednostek (Holoenzym ca D)

5 Promotor prokariotyczny Obejmuje dwie podstawowe sekwencje zaangażowane w kontrolę transkrypcji: TATAAT (-10 pz) i TTGACA (-35 pz)

6 Inicjacja transkrypcji u prokariontów Polimeraza RNA wiąże się do DNA i przesuwa się po nim aż do odnalezienia promotora Podjednostka sigma rozpoznaje sekwencję -35 pz i powoduje ścisłe związanie polimerazy. Na obszarze -10 pz następuje rozplatanie podwójnej helisy DNA

7 Inicjacja i elongacja transkrypcji u prokariontów Podjednostka sigma odłącza się od czterech pozostałych podjednostek polimerazy. Polimeraza kontynuuje transkrypcję

8 System regulacji operonowej u bakterii

9 Represor lambda (helix-turn-helix)

10 Elementy regulatorowe genów eukariotycznych

11 Białka związane z transkrypcją u eukariontów należą do 4 zróżnicowanych funkcjonalnie grup 1. Podstawowy aparat transkrypcyjny i związane z nim ogólne czynniki transkrypcyjne (GTF - General Transcription Factors) 2. Specyficzne w stosunku do sekwencji, wiążące się z DNA czynniki transkrypcyjne (TF). 3. Duże wielo-podjednostkowe kompleksy koaktywatorów i innych kofaktorów. 4.Białka związane z chromatyną

12 Podstawowy aparat transkrypcyjny i związane z nim ogólne czynniki transkrypcyjne (GTF - General Transcription Factors) Pol II - podjednostkowy holoenzym, wymaga dodatkowych czynników (TFII: A, B, D, E, F, H) dla rozpoznania promotora i inicjacji. TFIIB – umiejscawia Pol II na promotorze TFIIH – rozplata DNA TFIID – podjednostkowy kompleks odpowiedzialny za ogólne rozpoznanie promotora (zawiera TBP i TAFs (TBP- Assiociated Factors – odpowiedzialne za specyficzność i różnorodność odpowiedzi transkrypcyjnych)

13 Funkcja TBP-Associated Factors (TAFs)

14 Duże wielo-podjednostkowe kompleksy koaktywatorów i innych kofaktorów. Białka z AT-hook, zdolne do zginania DNA

15 Specyficzne w stosunku do sekwencji, wiążące się z DNA czynniki transkrypcyjne (TF).

16 Specyficzne w stosunku do sekwencji, wiążące się z DNA czynniki transkrypcyjne (TF) - 2

17 Czynnik transkrypcyjny AP-1 (Leu-Zip)

18 Czynnik transkrypcyjny Sp1

19 Funkcja enhancerów

20 Izolatory rozgraniczają domeny kontrolowane przez różne promotory

21 Meyerowitz 2002

22 Rodziny czynników transkrypcyjnych w Arabidopsis

23 Rodziny Homeobox (HB) i Zinc-Finger-Homeobox (ZF-HB) w Arabidopsis Rodzina Homeobox w Arabidopsis zawiera klasy z różnymi kombinacjami domen białkowych, różnice wynikają też z fiologenezy domeny HB. Specyficzny układ domen (leucine zipper, PHD finger, STAR) wynika z ich mieszania charakterystycznego dla roślin, nie występuje w innych królestwach (Drosophila, C. elegans, drożdże). Białka ZF-HB mają specyficzny tylko dla roślin motyw koordynujący cynk.

24 Porównanie rodzin czynników transkrypcyjnych u eukariontów

25 Zawartość i rozkład rodzin czynników transkrypcyjnych u eukariontów

26 Rodzina czynników transkrypcyjnych: AP2/EREBP i profile ekspresyjne z mikromacierzy dla różnych części i organów. Wzrost transkrypcji: czerwone – ponad 8-krotny, różowe - 2- do 8- krotny; żółte - ±2-krotny; Spadek transkrypcji: zielone ponad 2-krotny. Brak transkrypcji – szare.

27

28 Chromatyna w regulacji transkrypcji

29

30

31

32 Chromatin regulators act as common modifiers of diverse signaling pathways Systematic mapping of genetic interactions in C. elegans identified six hub genes that enhance the phenotypic consequences of mutations in many different pathways. All six hub genes encode components of chromatin modifying complexes. Chromatin modifiers may function as genetic buffers (similar to hsp90) preventing cumulation of effects of mutations in multiple functionally unrelated genes and in many otherwise unlinked pathways. Interaction network for EGF signaling. Lehner et al. Nature Genet. (2006)

33 Lokalizacja ogonów histonowych w nukleosomie H2A H2B H3 H4 H3 H2A H2B

34 Acetylacja lizyny

35 Modyfikacje histonów ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPH SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLAR DFKTD Lysine acetylation Arginine Methylation Lysine Methylation KRKTV Serine Phosphorylarion H3 H4

36 Modyfikacje histonów SGRGKQGGKARAKAKTRSSRAGLQFPVGRV PEPSKSAPAPKKGSKKAVTKAQKKDGKKRK PKKTE Lysine acetylation Arginine Methylation Lysine Methylation VTKYT Serine Phosphorylarion H2A H2B Lysine Ubiquitination

37 Kod histonowy

38 Wzór metylacji H3K9 w Arabidopsis DAPI H3K9 After Jackson et al., Chromosoma 112:

39 min % aktyna Tsi1 NtC7 osmotyna Analiza odpowiedzi tytoniowych komórek BY-2 na 250mM NaCl anty-fosfo(S10)-H3 anty-fosfo(S10)- acetyl(K14)-H3 intensywność sygnału western-blot, wyrażonaw jednostkach umownych, przypadająca na ilość białka min min. anty-acetyl-H min min min.

40 min. anty-fosfo(S10)-H3 DREB1A DREB2A RD29A COR15A aktyna kontrola pozytywna Analiza odpowiedzi linii Arabidopsis thaliana T87 na 250mM NaCl intensywność sygnału western-blot, wyrażonaw jednostkach umownych, przypadająca na ilość białka anty-fosfo(S10)- acetyl(K14)-H min.

41 Metylacja cytozyn w DNA Reaction: Cytosine 5-methylcytosine (5mC) Enzymes: Diverse group of DNA methyltransferases (Dnmts) Sequence context: CpG – animals CpG (major), CpNpG, CpNpNp - plants

42 Kingston, R.E., Narlikar, G.J. Genes&Development 13: (1999) ATP dependent Chromatin Remodeling

43 ATPases of DEXD/H family are motor subunits of chromatin remodeling complexes DEXD/H HelicC DEXD/H HelicC SNF2_N

44 ATPase ChromodomainSANT/SLIDEBromodomain Major types of ATP-dependent chromatin remodeling complexes Mi2 Swp 73 Swi3 Snf5 Snf2 ISWI SWI/SNFISWIMi2

45 Visualization of the remodeling activity: sliding assay with nucleosomes reconstituted on 248bp rDNA End positionCenter position

46 Sliding of nucleosomes induced by Arabidopsis ATPase DDM1 (Decrease in DNA Methylation 1) DDM1 A -ATP DDM1 -ATP B Brzeski&Jerzmanowski J.Biol.Chem. 2003

47 Modyfikacje histonów w aktywacji i wyciszaniu tranaskrypcji

48 Interferencja RNA (RNAi) w ustanawianiu stanu nieaktywnej chromatyny

49

50 Chromatynowy system aktywacji i hamowania transkrypcji From: Stevenson & Jarvis

51 AtSWP73 AtSWI3 BSH (SNF5) AtSNF2 Hipotetyczny kompleks SWI/SNF w Arabidopsis

52 Major remodeling ATPases

53 Two distinct and highly conserved subclasses of SWI/SNF complexes occur in yeast and animals Subfamily SWI/SNF/BAP/BAF Subfamily RSC/pBAP/pBAF (non-essential) (essential) ______________________________________________________________________________________________________________________ SWI/SNF BAP BAF RSC pBAP pBAF yeast Drosophila human yeast Drosophila human ______________________________________________________________________________________________________________________ Swi2/Snf2 Brahma BRG1 or hBRM Sth1/Nsp1 Brahma BRG1 Swi3 BAP155/Moira BAF170 and BAF155 Rsc8 BAP155/Moira BAF170&BAF155 Snf5 Snr1 hSNF5/INI1 Sfh1 Snr1 hSNF5/INI1 Swp73/Snf12 BAP60 BAF60a Rsc6 BAP60 BAF60a or BAF60b Swp61/Arp7 BAP55 BAF53 Rsc11/Arp7 BAP55 BAF53 Swp59/Arp9 Rsc12/Arp9 Actin Actin Actin Actin Swi1 OSA (ARID-domain protein) BAF250 Rsc1,Rsc2,Rsc4 Polybromo BAF180 Swp82 Snf6 Swp29/TafII30 Snf11 Rsc5,7,10,13-15 Rsc3, Rsc30

54 Is a functional pattern of SWI/SNF specialization maintained in plants? SWI/SNF family Signature subunit: OSA Yeast SWI/SNF Drosophila BAP Human BAF Plants? Signature subunit: Polybromo Yeast RSC Drosophila pBAP Human pBAF Plants? Non-essential Essential

55 Arabidopsis SWI/SNF complexes – the landscape of possibilities

56 Hypothetical organization of SWI/SNF remodeling in Arabidopsis

57 AtSWP73 AtSWI3 BSH (SNF5) AtSNF2 Hipotetyczny kompleks SWI/SNF w Arabidopsis

58 Homologi SWI3 w A. thaliana AtSWI3B (At2g33610) AtSWI3C (At1g21700) AtSWI3A (At2g47620) AtSWI3D (At4g34430) ySWI3

59 Drzewo filogenetyczne białek typu SWI3

60 BIP2 (3-32) HD2A ATSWI3C ATSWI3A ATSWI3B FCA ATSWI3D AtBRM ATSWP73A HD2B PRL2 AMIDASE PRL1 AKIN 10/11 BSH CobW PIRIN Farrona et. al., 2004 SAHH Interactions identified In Csaba Koncz laboratory Interactions verified in pGBT9/pGAD424 system Interactions verified in pGBT9/pACT2 system Weak interactions identified in pGBT9/pACT2 system Interactions identified by other researchers from our laboratory in the pGBT9/pGAD424 system Proteins studied in Csaba Koncz laboratory Core subunits of the SWI/SNF chromatin remodeling complex except for ATPase plus the FCA protein Proteins identified through the yeast two hybrd screen ATPase BIP1 (1-57) PUX2 SRC2 ANAC102 JMJC RPT3 AAA ATGP4 Di19 COP9 E3 ATAF2 ARM BIP3 (3-45) RPL12 esterase family protein BIP5 (1-30) BIP4 (3-46) BIP6 (11-16) BIP7 (11-17)


Pobierz ppt "Transkrypcja genów jądrowych u roślin i jej regulacja."

Podobne prezentacje


Reklamy Google