Pobieranie prezentacji. Proszę czekać

Pobieranie prezentacji. Proszę czekać

Zjawisko RNAi, mechanizmy epigenetyczne. siRNA i RNAi Zjawisko RNAi zachodzi dzięki małym interferującym RNA (siRNA). siRNA powstają z długich dwuniciowych.

Podobne prezentacje


Prezentacja na temat: "Zjawisko RNAi, mechanizmy epigenetyczne. siRNA i RNAi Zjawisko RNAi zachodzi dzięki małym interferującym RNA (siRNA). siRNA powstają z długich dwuniciowych."— Zapis prezentacji:

1 Zjawisko RNAi, mechanizmy epigenetyczne

2 siRNA i RNAi Zjawisko RNAi zachodzi dzięki małym interferującym RNA (siRNA). siRNA powstają z długich dwuniciowych RNA (dsRNA) pochodzenia egzgennego lub endogennego. Długie dsRNA są przecinane przez RNAazę III o nazwie Dicer, której homologi stwierdzono u wszystkich eukariontów. Oznacza to, że regulacja za pośrednictwem małych RNA jest b. stara ewolucyjnie i może mieć kluczowe znaczenie biologiczne. siRNA generowane przez Dicer to dwuniciowe cząsteczki ok. 22 nt, z 2 nt jednoniciowymi fragmentami na 3 końcach. Każdy łańcuch ma na 5 końcu fosforan a na 3 końcu -grupę OH. siRNA łączy się z kompleksem nukleazowym zwanym RISC (RNA- induced silencing complex), który ulega aktywacji poprzez katalizowaną przez helikazę RNA utratę jednego z łańcuchów dupleksu siRNA. Zaktywowany RISC odnajduje a następnie przecina mRNA komplementarny do siRNA.

3 Model RNAi

4 Składniki kompleksu RISC Kompleksy RISC zawierają konserwowane ewolucyjnie silnie zasadowe białko (ok. 100 kDa) z rodziny Argonaute (AGO)

5 Źródła siRNA Naturalnie występujące siRNA powstają z transpozonów, wirusów, które wytwarzają dsRNA podczas replikacji i innych rodzajów dwukierunkowo transkrybowanych, powtarzających się sekwencji

6 U niektórych organizmów (nicienie, grzyby) siRNA mogą być amplifikowane z udziałem RNA zależnej RNA polimerazy (RdRp)

7 U Drosophila i ssaków RNAi indukowane przez dsRNA zanika zwykle po kilku podziałach, organizmy te nie mają RdRp.

8 miRNA (microRNA) U ssaków, C. elegans, Drosophila i roślin wykryto setki małych RNA, które nazwano miRNA (microRNA), nieodróżnialnych pod względem właściwości biochemicznych od aktywnych siRNA (ok.22 nt, 5P, 3OH). Wspólną cechą tych miRNA (odróżniającą je od klasycznych siRNA) jest to, że sekwencje ich odnajdywane są w trzonkach charakterystycznej struktury stem-loop, zwykle ok. 70 nt typu niedoskonałych szpilek do włosów, z wybrzuszeniami i wewnętrznymi pętlami. miRNA powstają z długich pierwotnych transkryptów (pri-miRNA), które są następnie w jądrze przycinane do charakterystycznych szpilek do włosów o długości ok. 70 nt. Te ostatnie są eksportowane do cytoplazmy, gdzie Dicer wytwarza z nich miRNA.

9 Wytwarzanie siRNA i miRNA

10 RNAi (RNA interference) cechą charakterystyczną wszystkich odmian RNAi są małe 21-24nt RNA RNAi powstało najprawdopodobniej jako mechanizm obrony przeciw wirusom, występuje u wszystkich badanych eukariontów RNAi został wykorzystany przez komórki do utrzymywania heterochromatyny na cetromerach i obszarach zawierających wielokrotne powtórzenia odmianą RNAi używaną przez wszystkie znane eukarionty wielokomórkowe jest RNAi z udziałem miRNA

11 21-24 nt małe RNA RISC (RNA induced Silencing Complex) cięcie mRNA lub inhibicja translacji RITS (RNA induced Transcriptional Silencing) tworzenie heterochromatyny: metylacja DNA, metylacja histonu H3 K9 prekursor dsRNA miRNA siRNA TGS (Transcriptional Gene Silencing) PTGS (Post Transcriptional Gene Silencing) model RNAi

12 RISC (RNA induced Silencing Complex) RITS (RNA induced Transcriptional Silencing) TGS (Transcriptional Gene Silencing) PTGS (Post Transcriptional Gene Silencing) regulacja ekspresji genów (30% ludzkich genów) Integralność centromerów, kontrolowanie transpozonów, regulacja ekspresji genów? nt małe RNA prekursor dsRNA model RNAi

13 Rola miRNA Wyciszanie genów za pośrednictwem miRNA jest niezbędne w przebiegu rozwoju roślin i zwierząt

14 Mechanizmy epigenetyczne

15 Znaczenie biologiczne i definicja operacyjna pamięci komórkowej W organizmach wielokomórkowych niezbędne jest zachowanie tożsamości komórek, stanu ustalanego w trakcie rozwoju. Tożsamość komórek sprowadza się do charakterystycznego profilu ekspresji genów. Pamięć komórkowa jest mechanizmem epigenetycznym umożliwiający ustalenie i dziedziczenie tożsamości komórek (określonego profilu ekspresji genów).

16 Dziedziczenie epigenetyczne:definicja i mechanizmy D.E.: dziedziczne modyfikacje funkcji genów nie związane ze zmianami w sekwencji DNA Podstawowe mechanizmy epigenetyczne: Modyfikacje chromatyny Metylacja DNA: CpG, CpNpG, CpNpNp (asymetryczna)

17 Chromatyna – substrat modyfikacji epigenetycznych

18 Acetylacja lizyny

19 Modyfikacje histonów ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPH SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLAR DFKTD Lysine acetylation Arginine Methylation Lysine Methylation KRKTV Serine Phosphorylarion H3 H4

20 Modyfikacje histonów SGRGKQGGKARAKAKTRSSRAGLQFPVGRV PEPSKSAPAPKKGSKKAVTKAQKKDGKKRK PKKTE Lysine acetylation Arginine Methylation Lysine Methylation VTKYT Serine Phosphorylarion H2A H2B Lysine Ubiquitination

21 Lokalizacja ogonów histonowych w nukleosomie H2A H2B H3 H4 H3 H2A H2B

22 Po-translacyjne modyfikacje histonów w nukleosomie wg. B.Turner, Cell 2002

23 Organizacja DNA w jądrze

24 Determinanty aktywnej i wyciszonej chromatyny

25 Przykład przeciwstawnych funkcji modyfikacji histonów H3/H4 AcLys/H3metLys4(H3K4) - związane z rejonami aktywnej transkrypcji H3/H4 Lys+/H3metLys9 (H3K9) - związane z rejonami wygaszonej transkrypcji.

26 Metylacja DNA zamienia cytozyne w 5-metylo cytozynę

27 Metylacja DNA u eukariontów Nie jest uniwersalna; występuje u ssaków i roślin kwiatowych. Zmienność gatunkowa, tkankowa i w odniesieniu do lokalizacji na chromosomach. Rozpoznawana przez rodzinę białek zawierających domenę wiążącą się do metylo-CpG (methyl-CpG binding domain - MBD). Zciąga kompleksy białkowe indukujące lokalne zmiany w strukturze chromosomów. Wyłącza ekspresję genów.

28 Przykład ewolucyjnego efektu epimutacji (zmiany we wzorze metylacji DNA) From Cubas et al 1999, Nature 401: Lcyc kontroluje symetrię grzbietowo- brzuszną kwiatu; u mutanta nieaktywny z powodu silnej, dziedziczonej metylacji

29 Kingston, R.E., Narlikar, G.J. Genes&Development 13: (1999) PRZEBUDOWA CHROMATYNY ZALEŻNA OD ATP

30 Ryc.1. Systematyka ATP-zależnych kompleksów remodelujących chromatynę (wg Geeta, 2002). Kompleksy typu SWI/SNF Kompleksy typu ISWI Kompleksy typu Mi2 ATP-ase bromo-SANT chromo- PHD fingers Saccharomyces cerevisie Homo sapiens Drosophila melanogaster

31 Enzymy modyfikujące histony i DNA a koncepcja procesywności HAT – acetylotransferazy histonów (bromodomena) HDAC – deacteylazy histonów HMT – metylotransferazy histonów (chromodomena). CMT3 – DNA metylotransferaza (chromodomena)

32 Kompleksy remodelujące chromatynę – procesywność Mi2 Swp 73 swi3 snf5 swi2 ISWI ATPase ChromodomainSANT/SLIDEBromodomain SWI/SNF typeISWI typeMi2 type

33 Przebudowa chromatyny a metylacja DNA

34 Kluczowa funkcja białka DDM1- Decrease in DNA Methylation 1 ddm1 – 70% spadek poziomu metylacji DNA (Arabidopsis) = deregulacja ekspresji genów i aktywacja milczących transpozonów (lsh u myszy – podobnie). ddm1 – zmiany w rozkładzie H3K9 w chromosomach. DDM1 nie jest DNA-metylotransferazą.

35 Filogeneza nadrodziny SWI2/SNF2

36 41 SNF2 proteins in plants: genes control and beyond Kniżewski, Ginalski & Jerzmanowski, Trends in Plant Science, 2008

37 rDDM1 jest ATPazą aktywowaną przez DNA i chromatynę

38 Aktywność DDM1 w stosunku do nukleosomu Pozycja skrajnaPozycja centralna

39 Właściwości i funkcja DDM1 DDM1 jest czynnikiem remodelującym chromatynę (z udziałem ATP). DDM1 samodzielnie nie rozpoznaje metylacji DNA. DDM1 jest kluczowym czynnikiem łączącym remodeling chromatyny i wprowadzanie/utrzymywanie metylacji DNA

40 Architektura chromatyny w jądrze

41 Znaczniki epigenetyczne związane ze stanami chromatyny ATP-dependent chromatin remodeling ATP-dependent chromatin remodeling ATP- dependent chromatin remodeling


Pobierz ppt "Zjawisko RNAi, mechanizmy epigenetyczne. siRNA i RNAi Zjawisko RNAi zachodzi dzięki małym interferującym RNA (siRNA). siRNA powstają z długich dwuniciowych."

Podobne prezentacje


Reklamy Google