Pobieranie prezentacji. Proszę czekać

Pobieranie prezentacji. Proszę czekać

Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Modelowanie, czyli jak to działa? Dla zabawy Dla prezentacji czegoś Dla udowodnienia.

Podobne prezentacje


Prezentacja na temat: "Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Modelowanie, czyli jak to działa? Dla zabawy Dla prezentacji czegoś Dla udowodnienia."— Zapis prezentacji:

1 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Modelowanie, czyli jak to działa? Dla zabawy Dla prezentacji czegoś Dla udowodnienia czegoś Dla łatwiejszego zrozumienia całości Po co modelować?

2 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Rodzaje modeli i modelowania 1. Modelowanie obiektu

3 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Rodzaje modeli i modelowania 2. Modelowanie otoczenia

4 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Rodzaje modeli i modelowania model obiektu + model otocznia = model zjawiska model + opis parametrów modelu ustawienia symulacji 3. Modelowanie zjawiska

5 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Modelowanie w biologii - biologia teoretyczna Biologia teoretyczna jest dziedziną naukową traktującą zagadnienia biologiczne w ujęciu obliczeń ilościowych biofizyka bioinformatyka ewolucjonizm i filogenetyka statystyka i biologia matematyczna

6 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Modelowanie molekularne Każde działanie prowadzące do uzyskania modelu zalicza się do MODELOWANIA. Modelowanie molekularne – obejmuje wszystkie metody teoretyczne i techniki komputerowe służące do modelowania cząsteczek chemicznych i symulacji zachowywania się cząsteczek w określonych warunkach. Dynamika molekularna

7 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł JastrzębskiModele Budowa / struktura / formaty plików Prezentacja modeli - wizualizacja

8 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Struktura molekuł

9 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Struktury drugorzędowe Helisy –prawoskrętna –lewoskrętna –3-turn helix (3/10 helix). Min length 3 residues (G) –4-turn helix (alpha helix). Min length 4 residues (H) –5-turn helix (pi helix). Min length 5 residues (I) Beta-kartki (E) –równoległe –anty-równoległe –przeciwległe Zwroty stabilizowane wiązaniami wodorowymi (3, 4 lub 5 turn) (T) Nitka – struktura dowolna, nieokreślona (C)

10 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Struktura molekuł Wiązanie peptydoweKąty torsyjne Dozwolone struktury i Ramachandran Plot

11 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Model struktury pierwszorzędowej białka Plik w formacie FASTA >gi| |gb|AAD | cytochrome b [Elephas maximus maximus] LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX IENYElephas maximus maximus >nazwa_sekwencji_1 sekWENCJAdanEGObiaLKAlubniCInukLEOTYDOWEJ >nazwa_sekwencji_2 kolEJNAsekWENCJAdowOLNEGOwybRANEGOBIALKAlubniciDNA >kolejna itd Kryteria formatu FASTA: -Tylko sekwencja lub sekwencja z opisem -Opis danej sekwencji w oddzielnej linijce (powyżej) i poprzedzony znakiem > -Sekwencja TYLKO z dozwolonych znaków dowolnej wielkości -Każda linijka sekwencji maksymalnie do 80 znaków

12 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Model struktury drugorzędowej białka > plik FASTA sekwencji i struktury drugorzedowej fragmentu hemoglobiny SSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTN CCCHHHHHHHHCPCCCCCCCCEEEEECCCHHHHHHHHHCEEECCCCPCCC

13 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Modele struktur trzecio- i czwartorzędowych białek

14 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Struktura plików formatu PDB

15 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł JastrzębskiModelowanie Dynamika molekularna

16 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski CADD komputerowo wspomagane projektowanie leków

17 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł JastrzębskiFARMAKOFOR Farmakofor jest modelem opisującym relacje przestrzenne między elementami wspólnymi dla ligandów oddziałujących z danym receptorem

18 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Metody przewidywania struktury drugorzędowej białek GOR-I

19 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Metody przewidywania struktury drugorzędowej białek GOR-I

20 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Otrzymywanie modeli struktury białek 1.Metody laboratoryjne –NMR, X-ray 2.Teoretyczne przewidywanie struktury –Ab initio protein modelling –Comparative protein modelling modelowanie homologiczne threading (nawlekanie)

21 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł JastrzębskiNMR

22 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł JastrzębskiX-RAY

23 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski 1. Ab initio (de novo) symulacje: - Minimalizacja energii (EM), - dynamika molekularna (MD), - Monte Carlo Metody przewidywania struktury przestrzennej białek in silico 2. comparative / homology modeling GHIKLSYTVNEQNLKPERFFYTSAVAIL THEESEQTEN-CESALIGN--NICELY ||| ||| || || ||||| |||||| THESEQ-EN-CE-ALIGNEDNICELY

24 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Minimalizacja Energii

25 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Minimalizacja Energii

26 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Algorytm lejkowy The energy surface of a folding funnel from experimental data for the folding of lysozyme. The axes are defined as follows: E represents the energy of the system, Q is defined as the proportion of native contacts formed, and P is a measure of the available conformational space. Three pathways are shown corresponding to (yellow) fast folding, (green) slow folding pathway that crosses the high energy barrier, and (red) slow folding pathway which returns to a less folded state before following the pathway for fast folding (reproduced from Dobson et al., 1998).[2]2

27 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Protein folding

28 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Modelowanie homologiczne 1. Odnalezienie modeli białek homologicznych o sekwencji podobnej co najmniej 20-25%

29 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski 2. Najlepsze zestawienie sekwencji homologicznych Modelowanie homologiczne +

30 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski 3. Threading - nawlekanie Modelowanie homologiczne Target Template

31 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski 4. Optymalizacja modelu / projektu Modelowanie homologiczne

32 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski 5. Weryfikacja modelu Modelowanie homologiczne PROCHECK analiza stereochemiczna jakości struktury WHATIF/ WHATCHECK sprawdzanie struktury atomowej ( rotamers bond angles, bond lengths …) area and volume calculations

33 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł JastrzębskiPROCHECK

34 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł JastrzębskiPROCHECK

35 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł JastrzębskiWizualizacja

36 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Dynamika molekularna

37 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł JastrzębskiNarzędzia

38 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Edytory tekstu

39 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Programy do wizualizacji, renderingu i modelowania RasMol

40 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Cn3D Programy do wizualizacji, renderingu i modelowania

41 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski VMD NAMD Programy do wizualizacji, renderingu i modelowania

42 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski SPDBV Programy do wizualizacji, renderingu i modelowania

43 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Programy do wizualizacji i renderingu PovRay

44 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Programy do wizualizacji i renderingu

45 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Animacja działania ATPazy

46 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Zaawansowane symulacje komputerowe

47 Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Fine


Pobierz ppt "Bioinformatyka 2007/2008 wykład 4 Biotechnologia UWM dr Jan Paweł Jastrzębski Modelowanie, czyli jak to działa? Dla zabawy Dla prezentacji czegoś Dla udowodnienia."

Podobne prezentacje


Reklamy Google