Pobieranie prezentacji. Proszę czekać

Pobieranie prezentacji. Proszę czekać

Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Struktury molekularne Bioinformatyczne metody wizualizacji, formaty plików,

Podobne prezentacje


Prezentacja na temat: "Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Struktury molekularne Bioinformatyczne metody wizualizacji, formaty plików,"— Zapis prezentacji:

1 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Struktury molekularne Bioinformatyczne metody wizualizacji, formaty plików, przewidywanie struktur biomolekuł (na przykładzie białek).

2 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Struktury molekuł

3 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Przykładowe formaty plików

4 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Model struktury pierwszorzędowej białka Plik w formacie FASTA >gi| |gb|AAD | cytochrome b [Elephas maximus maximus] LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX IENYElephas maximus maximus >nazwa_sekwencji_1 sekWENCJAdanEGObiaLKAlubniCInukLEOTYDOWEJ >nazwa_sekwencji_2 kolEJNAsekWENCJAdowOLNEGOwybRANEGOBIALKAlubniciDNA >kolejna itd Kryteria formatu FASTA: -Tylko sekwencja lub sekwencja z opisem -Opis danej sekwencji w oddzielnej linijce (powyżej) i poprzedzony znakiem > -Sekwencja TYLKO z dozwolonych znaków dowolnej wielkości -Każda linijka sekwencji maksymalnie do 80 znaków

5 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Dozwolone symbole w formacie FASTA A --> adenosine M --> A C (amino) C --> cytidine S --> G C (strong) G --> guanine W --> A T (weak) T --> thymidine B --> G T C U --> uridine D --> G A T R --> G A (purine) H --> A C T Y --> T C (pyrimidine) V --> G C A K --> G T (keto) N --> A G C T (any) - gap of indeterminate length For those programs that use amino acid query sequences (BLASTP and TBLASTN), the accepted amino acid codes are: A alanine P proline B aspartate or asparagine Q glutamine C cystine R arginine D aspartate S serine E glutamate T threonine F phenylalanine U selenocysteine G glycine V valine H histidine W tryptophan I isoleucine Y tyrosine K lysine Z glutamate or glutamine L leucine X any M methionine * translation stop

6 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Format FASTA >gi| |gb|AAT | cytochrome c oxidase subunit III [Homo sapiens] MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLMLGLLTNTLTMYQWWRDVTRESTYQGH HTPPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTGITPLNPLEVPLLNTSVLLAS GVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASEYFESPFTISDGIYGSTFFVATGFHGLHVII GSTFLTICFIRQLMFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLMLGLLTNTLTMYQWWRDVTRESTYQGH HTPPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTGITPLNPLEVPLLNTSVLLAS GVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASEYFESPFTISDGIYGSTFFVATGFHGLHVII GSTFLTICFIRQLMFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS mthqshayhm vkpspwpltg alsallmtsg lamwfhfhsm tllmlglltn tltmyqwwrd 61 vtrestyqgh htppvqkglr ygmilfitse vfffagffwa fyhsslaptp qlgghwpptg 121 itplnplevp llntsvllas gvsitwahhs lmennrnqmi qallitillg lyftllqase 181 yfespftisd giygstffva tgfhglhvii gstflticfi rqlmfhftsk hhfgfeaaaw 241 ywhfvdvvwl flyvsiywwg s

7 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Model struktury drugorzędowej białka > plik FASTA sekwencji i struktury drugorzedowej fragmentu hemoglobiny SSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTN CCCHHHHHHHHCPCCCCCCCCEEEEECCCHHHHHHHHHCEEECCCCPCCC

8 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Struktury drugorzędowe Helisy –prawoskrętna –lewoskrętna –3-turn helix (3/10 helix). Min length 3 residues (G) –4-turn helix (alpha helix). Min length 4 residues (H) –5-turn helix (pi helix). Min length 5 residues (I) Beta-kartki (E) –równoległe –anty-równoległe –PSI-loop Zwroty (spinki) stabilizowane wiązaniami wodorowymi (3, 4 lub 5 turn) (T) Nitka – struktura dowolna, nieokreślona (C)

9 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Struktury przestrzenne molekuł Wiązanie peptydowe Kąty torsyjne Dozwolone kąty i Ramachandran Plot

10 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Modele struktur trzecio- i czwartorzędowych białek

11 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Struktura plików formatu PDB PDB ID i nazwy modeli: 3INS.pdb 1OCC.pdb 1HBB.pdb 1HBS_B.pdb

12 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski ATOM 1 N GLU E N ATOM 2 CA GLU E C ATOM 3 C GLU E C … ATOM 2238 CE LYS E C ATOM 2239 NZ LYS E N ATOM 2240 N ALA E N ATOM 2241 CA ALA E C Struktura plików formatu PDB Atom nr pierw. aa nr X Y Z współcz. rodz Atom | Grupa | koordynaty |inne parametry

13 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębskiprzewidywanie

14 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Profil hydrofobowości Skale hydrofobowości Analiza pozycji w sekwencji Analiza regionów sekwencji profil

15 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Metody przewidywania struktury drugorzędowej białek GOR-I

16 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Metody przewidywania struktury drugorzędowej białek GOR-I

17 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Regiony transmembranowe

18 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Regiony transmembranowe The prediction of transmembranous regions is either based on the hydrophobicity method (Kyte & Doolittle, 1982) or on more specific method such as the positive inside rule (Von Heijne, 1992). The method is based on the positive inside rule that indicates that the cytoplasmic side of a membrane is rather positively charged whereas the external side is rather negatively charged. The hydrophobicvity scale is :

19 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Regiony transmembranowe The hydrophobicity of segments is first measured by calculating the weighted sum on a 21 AA trapezoid sliding window with a central, 11 AA rectangular section and 2 flanking wedge-like sections each 5AA long. The cytoplasmic regions (In) are predicted using the positive-inside rule and the periplasmic regions (Out) of bacterial inner membrane proteins. Thus the formulae is:

20 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Otrzymywanie modeli struktury białek 1.Metody laboratoryjne –NMR, X-ray 2.Teoretyczne przewidywanie struktury –Ab initio protein modelling –Comparative protein modelling modelowanie homologiczne threading (nawlekanie)

21 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł JastrzębskiNMR

22 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł JastrzębskiX-RAY

23 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski 1. Ab initio (de novo) symulacje: - Minimalizacja energii (EM), - dynamika molekularna (MD), - Monte Carlo Metody przewidywania struktury przestrzennej białek in silico 2. comparative / homology modeling GHIKLSYTVNEQNLKPERFFYTSAVAIL THEESEQTEN-CESALIGN--NICELY ||| ||| || || ||||| |||||| THESEQ-EN-CE-ALIGNEDNICELY

24 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Minimalizacja Energii

25 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Minimalizacja Energii

26 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Algorytm lejkowy The energy surface of a folding funnel from experimental data for the folding of lysozyme. The axes are defined as follows: E represents the energy of the system, Q is defined as the proportion of native contacts formed, and P is a measure of the available conformational space. Three pathways are shown corresponding to (yellow) fast folding, (green) slow folding pathway that crosses the high energy barrier, and (red) slow folding pathway which returns to a less folded state before following the pathway for fast folding (reproduced from Dobson et al., 1998).[2]2

27 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Protein folding

28 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Modelowanie homologiczne 1. Odnalezienie modeli białek homologicznych o sekwencji podobnej co najmniej 20-25%

29 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski 2. Najlepsze zestawienie sekwencji homologicznych Modelowanie homologiczne +

30 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski 3. Threading - nawlekanie Modelowanie homologiczne Target Template

31 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski 4. Optymalizacja modelu / projektu Modelowanie homologiczne

32 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębskiwizualizacja

33 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Podstawowe elementy w wizualizacji molekularnej Punkty i linie (druty) (points and wires)

34 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Podstawowe elementy w wizualizacji molekularnej Kule i pręty (słomki, rurki) (balls and sticks)

35 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Podstawowe elementy w wizualizacji molekularnej Sfery i powierzchnie (spheres and surfaces)

36 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Podstawowe elementy w wizualizacji molekularnej Sfery i powierzchnie (spheres and surfaces)

37 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Podstawowe elementy w wizualizacji molekularnej

38 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Podstawowe elementy w wizualizacji molekularnej Wstążki i nici (ribbons and coils)

39 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Podstawowe kolory w wizualizacji molekularnej atomy

40 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Podstawowe kolory w wizualizacji molekularnej Ładunki (charges)

41 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Podstawowe typy wizualizacji molekularnej wireframe (obraz szkieletowy)

42 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Podstawowe typy wizualizacji molekularnej backbone (kręgosłup)

43 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Podstawowe typy wizualizacji molekularnej sticks (pręty, rurki -wiązania chemiczne)

44 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Podstawowe typy wizualizacji molekularnej ball and sticks (kulki i pręty – atomy i wiązania)

45 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Podstawowe typy wizualizacji molekularnej ribbons i cartoon (wstążki – wzajemne ułożenie powierzchni wiązań peptydowych)

46 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Podstawowe typy wizualizacji molekularnej wstążki

47 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Podstawowe typy wizualizacji molekularnej spacefill (kule / sfery oddziaływać sił Van der Waalsa - VDW)

48 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski sfery VDW Podstawowe typy wizualizacji molekularnej

49 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski molecular surface (powierzchnia molekularna) accessible surface area (powierzchnia dostępu)

50 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Molecular vs. Accessible area

51 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski molecular surface (powierzchnia molekularna) accessible surface area (powierzchnia dostępu) electrostatic surface area (powierzchnia elektrostatyczna) Podstawowe typy wizualizacji molekularnej

52 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Programy do wizualizacji, renderingu i modelowania RasMol

53 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Programy do wizualizacji i renderingu

54 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski SPDBV Programy do wizualizacji, renderingu i modelowania

55 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł JastrzębskiRendering Ray tracing (śledzenia promienia) – jedna z technik renderingu

56 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Programy do wizualizacji i renderingu PovRay

57 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Wizualizacja wektorowa

58 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Wizualizacja renderowana (OpenGL)

59 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Wizualizacja renderowana (ray-tracing)

60 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł JastrzębskiRay-tracing

61 Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Cn3D Programy do wizualizacji, renderingu i modelowania


Pobierz ppt "Wstęp do bioinformatyki Wykład 3 Biotechnologia UWM Dr Jan Paweł Jastrzębski Struktury molekularne Bioinformatyczne metody wizualizacji, formaty plików,"

Podobne prezentacje


Reklamy Google