Pobieranie prezentacji. Proszę czekać

Pobieranie prezentacji. Proszę czekać

Analiza właściwości białek Bazy danych, przeszukiwanie, porównywanie sekwencji aminokwasowych.

Podobne prezentacje


Prezentacja na temat: "Analiza właściwości białek Bazy danych, przeszukiwanie, porównywanie sekwencji aminokwasowych."— Zapis prezentacji:

1 Analiza właściwości białek Bazy danych, przeszukiwanie, porównywanie sekwencji aminokwasowych.

2 Bazy danych zawierające sekwencje aminokwasowe białek. 1.SWISS-PROT: powstała w 1986 (A.Bairoch) 2.TrEMBL: powstała w 1996; jest uzupełnieniem SWISS-PROT; dane pochodzą z automatycznych translacji EMBL CDS (« proteomiczna » wersja EMBL) 3.PIR-PSD: Protein Information Resources 4. PRF: Protein Research Foundation (Japan): Peptide/Protein Sequence Database (PRF/SEQDB) 5.GenPept: tworzona przez analizę uaktualnień GenBank dla regionów translacyjnych. 6.Wiele specjalistycznych białkowych baz danych dla specyficznych rodzin i grup białek. Np. : YPD (yeast proteins), AMSDb (antibacterial peptides), GPCRDB (7 TM receptors), IMGT (immune system) etc.

3 PDB (Protein Data Bank) SCOP (structural classification of proteins (according to the secondary structures)), BMRB (BioMagResBank; RMN results) DSSP: Database of Secondary Structure Assignments. 1.HSSP: Homology-derived secondary structure of proteins. 2.FSSP: Fold Classification based on Structure-Structure Assignments. Bazy danych zawierające dane na poziomie 2D i 3D

4 Metody przeszukiwania sekwencyjnych baz danych Entrez – na podstawie informacji na temat genu, nazwy i innych nie sekwencyjnych danych. Fasta, Blast- na podstawie sekwencji nukleotydowej bądź aminokwasowej.

5 Fasta Blast Fasta3 - przeszukuje białkowe i nukleotydowe bazy danych. Blastp- służy do wstępnego skanowania baz danych zawierających sekwencje aminokwasowe. Fastf3- porównuje różnorodne białka do biłakowych baz danych. Psi-blast – służy do wyszukiwania sekwencji o niskiej homologii. Bardziej czuły niż blastp. Fastx3 – porównuje sekwencje DNA z białkową bazą danych, porównuje odczytaną sekwencje DNA zgodnie z kierunkiem odczytu i odwrotnie. Phi-blast- służy do wyszukiwania sekwencji homologicznych na podstawie podanego wzoru i PSSM. rpsblast- służy do wyszukiwania konserwatywnych domen białkowych.

6 >gi| :1-235 DNA-specific endonuclease I [Salmonella typhimurium LT2] MYRNFSFAAALLAAAFSGQALADGINNFSQAKAASVKVNADAPGSFYCGCQI RWQGKKGVVDLESCGYKVRKNENRARRIEWEHVVPAWQFGHQRQCWQD GGRKNCAKDPVYRKMESDMHNLQPAIGEVNGDRGNFMYSQWNGGEGQYG QCAMKVDFKAKIAEPPARARGAIARIYFYMRDQYQLKLSRQQTQLFNVWD KQYPVTAWECERDARIAKVQGNHNPYVQRACQARKS Format FASTA >P1;CRAB_ANAPL ALPHA CRYSTALLIN B CHAIN (ALPHA(B)-CRYSTALLIN). MDITIHNPLI RRPLFSWLAP SRIFDQIFGE HLQESELLPA SPSLSPFLMR SPIFRMPSWL ETGLSEMRLE KDKFSVNLDV KHFSPEELKV KVLGDMVEIH GKHEERQDEH GFIAREFNRK YRIPADVDPL TITSSLSLDG VLTVSAPRKQ SDVPERSIPI TREEKPAIAG AQRK* Format PIR

7 Sygnatura Link do bazy danych Match

8 Score S (raw) Jest to suma wartości substytucji i przerw w danym wyrównaniu aattattca ||||| a--tcatca Przerwa (gap) mismatch S = Σ (identyczne, mismatch) – Σ (przerwy)

9 P – value (prawdopodobieństwo) Łaczy wyniki zwracane z danych wyrównań z prawdo- podobieństwem ich wystąpienia. Im mniejsza wartość (bliska równa, zeru) tego parametru tym zaufanie względem prawdziwości danego dopasowania jest większe.

10 E - Value Liczba wyrównań z danym score, która może być spodziewana losowo podczas przeszukiwania danej bazy danych. Jeżeli E = 10 to oznacza to że istnieje szansa na znalezienie tylko 10 takich dopasowań o wysokim (score). Jako wynik zwracane są tylko te dopasowania (matches) które, są powyżej wartości E. Im mniejsza wartość E tym bardziej rygorystyczna analiza zwracająca tylko kilka wyrównań.

11 Ustawienie globalne (global aligment) – ustawienie zakładające że sekwencje wejściowe są zasadniczo podobne do siebie na całej swojej długości. Ustawienie polega na próbie porównania ich ze sobą na całej ich długości od końca do końca tak aby znaleść najlepsze wyrównanie (z najwyższym score ) Ustawienie lokalne (local aligment) – wyrównanie które, wyszukuje dobrze pasujące do siebie segmenty pomiędzy dwoma sekwencjami. Nie polega ono na próbie porównania całych sekwencji tylko poszukiwaniu regionów o dobrej zgodności zgodnie z wyjściowymi parametrami.

12 N C N N N C C C Wyrównanie globalne Przerwy (Gap)

13 N C N N N C C C Wyrównanie lokalne N N C C

14 Gap extention- określa koszt jaki ponosi wyrównanie za obecność w nim kolejnych reszt. Koszt ten zwykle powinien być Mniejszy od kosztu gap open. W celu zmniejszenia długości przerwy wystarczy zwiększyć karę. Gap open – określa koszt jaki ponosi ustawienie za zainicjowanie przerwy. Gap end – określa koszt jaki ponosi ustawienie za zamknięcie przerwy Gap distance – kara za oddzielanie przerw

15 Niskie wartości dla kar za przerwy powodują zwracanie ustawień z wieloma przerwami i parami aminokwasowymi czy nukleotydowymi, ale ustawienie takie ma mniejsze znaczenie statystyczne w takim przypadku wyrównanie to powinno zostać skonfrontowane ze znaczeniem biologicznym tych podobieństw. Zbyt wysokie wartości kar mogą jednakże powodować brak możliwości znalezienia jakichkolwiek istotnych podobieństw w przypadku porównywania między sobą sekwencji o odległej homologii. Bądź w przypadku ustawień lokalnych odnajdywać pojedyncze regiony.

16 Znaczenie matryc substytucyjnych Są istotnym elementem każdego doświadczenia w którym istotna jest wiarygodna ocena uzyskanego wyniku w postaci wyrównania sekwencji. Odpowiednio dobrana matryca znacząco wpływa na jakość analizy. Matryce są bezpośrednim odzwierciedleniem teorii ewolucji Zrozumienie ich właściwości znacznie ułatwia dobór matrycy i zwiększa powodzenie w prowadzeniu badań

17 BLOSUM – Block substitution matrix Konstruowana jest na podstawie konserwatywnych regionów występujących w zespole ustawień bez możliwości wystąpienia w nich przerw. Opiera się na wyrównaniach lokalnych. W odróżnieniu od PAM matryca BLOSUM obliczana jest na podstawie grup ustawień sekwencji, w których nie wszystkie mutacje są obliczane tak samo (nie są równoznaczne) Matryca ta jest najlepsza do wykrywania lokalnych wyrównań. Blosum 62 jest najlepsza do wykrywania słabych podobieństw pomiędzy białkami. Blosum 45 jest najlepsza do wykrywania długich i słabych wyrównań

18

19 PAM – Point aminoacid mutation Bazują na globalnych ustawieniach blisko spokrewnionych ze sobą białek ( w skład ustawień wchodziły także regiony o niskiej homologii) Wszystkie matryce tej rodziny wywodzą się z matrycy PAM1 wyznaczonej na podstawie wyrównań różniących się od siebie na poziomie 1% (99% identyczności) Matryce o dużych wartościach (PAM 250) są bardziej przydatne Do przeszukiwania baz danych niż porównywania sekwencji. Matryce o niskiej wartości są bardziej czułe i pozwalają na właściwą ocenę wyrównania pomiędzy sekwencjami blisko spokrewnionych ze sobą białek

20 ARNDCQEG A2 R-26 N002 D024 C Q E G PAM 250

21 BLOSUM 45 PAM 250 BLOSUM 62 PAM 160 BLOSUM 90 PAM PDOBIEŃSTWO100

22 Metody porównywania dwóch sekwencji między sobą Blast 2 sequences – lokalne wyrównanie podobnie jak w klasycznym BLAST (http://www.ncbi.nlm.nih.gov/blast/bl2seq/bl2.html) EMBOSS PAA - -Needle – lokalne wyrównanie -Water - globalne wyrównanie

23 Metody porównywania więcej niż dwóch sekwencji ClustalW- bazuje na ustawieniach globalnych bądź semi- globalnych. Buduje ustawienia wielokrotne progresywnie z serii wyrównań podwójnych, według rozgałęzień na wyjściowym guide tree Ustawia wyrównania od najbardziej podobnych (bedących najbliżej na guide tree) do bardziej odległych. Przerwy powstałe na początku generowania wyrównań nie ulęgają zmianie. (automatycznie nie są poprawiane) T-COFFEE- kombinacja ustawień lokalnych i globalnych (ClustalW, Lalgin) używa bibliotek ustawień lokalnych i globalnych. Bardziej dokładne ustawienia pomiędzy sekwencjami o niskiej homologii

24 Metody konstruowania wyrównań wielokrotnych

25 S1S1 S2S2 S4S4 S3S3 S2S2 S4S4 S1S1 S3S3 Porównywanie sekwencji międzysobą (6 kombinacji) Obliczanie dystansu i tworzenie guide tree. ClustalW etapy (1)

26 S4S4 S2S2 S1S1 S3S3 S4S4 S2S2 S1S1 S3S3 Wyrównanie pomiędzy najbardziej podobnymi sekwencjami Wprowadzenie przerw dla optymalizacji wyrównania Wrównanie pomiędzy kolejnymi sekwencjami według guide tree ClustalW(2) Generowanie ustawienia wielokrotnego z wprowadzeniem nowych przerw bez możliwości zmiany przerw z ustawień pomiędzy dwoma sekwencjami (etap wcześniej)

27 Conclusion The Best Alignment Method: Your Brain The Right Data The Best Evaluation: Your Eyes Experimental Information (SwissProt) Bioinformatics course 2001


Pobierz ppt "Analiza właściwości białek Bazy danych, przeszukiwanie, porównywanie sekwencji aminokwasowych."

Podobne prezentacje


Reklamy Google